Tutoriel Biopython et traduction japonaise du livre de recettes (4.6)

4.6 The format method Vers 4.5 The format() method of the SeqRecord class gives a string containing your record formatted using one of the output file formats supported by Bio.SeqIO, such as FASTA: ** Le format SeqRecord () peut convertir l'enregistrement (séquence) en une chaîne prise en charge par Bio.SeqIO, par exemple FASTA **

from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.Alphabet import generic_protein

record = SeqRecord(
    Seq(
        "MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD"
        "GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK"
        "NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM"
        "SSAC",
        generic_protein,
    ),
    id="gi|14150838|gb|AAK54648.1|AF376133_1",
    description="chalcone synthase [Cucumis sativus]",
)

print(record.format("fasta"))

which should give:

>gi|14150838|gb|AAK54648.1|AF376133_1 chalcone synthase [Cucumis sativus]
MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD
GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK
NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM
SSAC

This format method takes a single mandatory argument, a lower case string which is supported by Bio.SeqIO as an output format (see Chapter 5). However, some of the file formats Bio.SeqIO can write to require more than one record (typically the case for multiple sequence alignment formats), and thus won’t work via this format() method. See also Section 5.5.4. *** méthode de format nécessite un argument, est le format de sortie pris en charge par Bio.SeqIO (chaîne inférieure). Cependant, si vous disposez de plusieurs tableaux, vous ne pouvez pas utiliser la méthode format (). Voir 5.5.4. *** ***